Host taxon 9606
Protein NP_000749.2
granulocyte-macrophage colony-stimulating factor precursor
Homo sapiens
Gene CSF2, UniProt P04141
>NP_000749.2|Haemophilus ducreyi 35000HP|granulocyte-macrophage colony-stimulating factor precursor
MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 5.06 | 5.06050944318035 | 3.5e-7 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)