Host taxon 10090
Protein NP_038576.1
histone H3.2
Mus musculus
Gene n/a, UniProt P84228
>NP_038576.1|Pseudomona aeruginosa PA01|histone H3.2
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ -3.96 | -3.95813908116093 | 0.00065 | 32071273 | |
Retrieved 1 of 1 entries in 54.2 ms
(Link to these results)