Host taxon 10090
Protein NP_062323.1
interleukin-36 alpha
Mus musculus
Gene Il1f6, UniProt Q149U6
>NP_062323.1|Pseudomona aeruginosa PA01|interleukin-36 alpha
MNKEKELRAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 4.99 | 4.99486256650325 | 0.034 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)