Host taxon 10090
Protein NP_081359.1
lysozyme-like protein 6 precursor
Mus musculus
Gene Lyzl6, UniProt Q9DA11
>NP_081359.1|Pseudomona aeruginosa PA01|lysozyme-like protein 6 precursor
MLKALFICVASCLLVVNDGNIIHRCSLAKILYEEDLDGFEGYSLPDWLCLAFVESNFNISKVNENVDGSFDYGIFQINSRYWCNDYQSHSENFCHVDCQELLSPNLISTIHCAKKIVSGPGGMKNWVEWKLHCLGRPLSYWMTGCHLG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 4.72 | 4.71837946698554 | 0.043 | 32071273 | |
Retrieved 1 of 2 entries in 71.1 ms
(Link to these results)