Host taxon 10090
Protein NP_899076.1
alpha-defensin 21 precursor
Mus musculus
Gene Defa21, UniProt Q8C1P2
>NP_899076.1|Yersinia pseudotuberculosis IP 32953|alpha-defensin 21 precursor
MKTLVLLSALILLAYQVQTDPIQNTDEETNTEEQPGEDDQAVSVSFGGQEGSALHEKLSRDLICLCRNRRCNRGELFYGTCAGPFLRCCRRRR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ -3.97 | -3.97333706648462 | 3.1e-5 | 28096329 | |
Retrieved 1 of 1 entries in 6.4 ms
(Link to these results)