Host taxon 10090
Protein NP_071859.1
neuroglobin isoform 2
Mus musculus
Gene Ngb, UniProt Q9ER97
>NP_071859.1|Yersinia pseudotuberculosis IP 32953|neuroglobin isoform 2
MERPESELIRQSWRVVSRSPLEHGTVLFARLFALEPSLLPLFQYNGRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLTSLGRKHRAVGVRLSSFSTVGESLLYMLEKCLGPDFTPATRTAWSRLYGAVVQAMSRGWDGE
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● -4.01 | -4.00597706639876 | 0.013 | 28096329 | |
Retrieved 1 of 3 entries in 42.5 ms
(Link to these results)