Host taxon 10090
Protein NP_001156350.2
protein FAM183B isoform 2
Mus musculus
Gene Fam183b, UniProt Q5NC57
>NP_001156350.2|Yersinia pseudotuberculosis IP 32953|protein FAM183B isoform 2
MAGRVGQMKNQDEVHQNQILRELFLKELRAQKLYTQYHVNPLRKAKFLNLIHHAAQGPKKKYSETQTEAQEIGWDPNPLINPDRQDHRLNHFRVYHDITLYKAKLWSLGEDDHQK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● -4.02 | -4.01635589419456 | 0.00036 | 28096329 | |
Retrieved 1 of 3 entries in 91 ms
(Link to these results)