Bacterial taxon 233412   Protein WP_010945720.1

50S ribosomal protein L4

Haemophilus ducreyi 35000HP

Gene rplD, UniProt Q7VKD3

>WP_010945720.1|Haemophilus ducreyi 35000HP|50S ribosomal protein L4
MELQVVGANALTVSETTFGREFNEALIHQVVVAYAAGARQGSRAQKTRAEVSGSGKKPWRQKGTGRARSGDIKSPIWRSGGTTFAAKPQDHSQKVNKKMYRGAIKSILSELVRQERLVVVEKFEVEAPKTKFLVQKLKDLALNDALIITASLDENLFLAARNLYKVDVRDVQGIDPVSLIAFDKVVITTDAVKQIEEMLA

 

Show protein visualisation   Find similar proteins   Download Table  
Host  Pathogen  Organism  Tissue  Time Post-Infection  Log2 Fold Change  p-Value  Reference  Note 
Human (Homo sapiens)9606Haemophilus ducreyi 35000HP 233412pathogenSkin tissue6-8 days●○○○○ 0,580.5773277995001280,005831213562 Bacterial control measured at mid-exponential growth phase
Retrieved 1 of 1 entries in 0,8 ms (Link to these results)