Bacterial taxon 233412   Protein WP_010945186.1

DUF218 domain-containing protein

Haemophilus ducreyi 35000HP

Gene n/a, UniProt n/a

>WP_010945186.1|Haemophilus ducreyi 35000HP|DUF218 domain-containing protein
MMWISNNSVRRLAGRLIRCLKCVAAGLLLAASMLLMVDGLTSWYVKDRLFTDIDQLPARPYAVVLGTAKFYASGELNLYYHYRLAAAAALYQQAKVDKLLVSGDNQTVYYNEPKVMRNDLVNMGVPASQVEQDFAGFRTLDSIIRAKQVYQLAPFVIVSQRFHCERALFIAKYYDIDAVCFAAKYPAGHIQVRVREFFARLGMLWDLLMHTQPDSLVKVDAKEIKSGNKR

 

Protein visualisation unavailable   Find similar proteins   Download Table  
Host  Pathogen  Organism  Tissue  Time Post-Infection  Log2 Fold Change  p-Value  Reference  Note 
Human (Homo sapiens)9606Haemophilus ducreyi 35000HP 233412pathogenSkin tissue6-8 days●○○○○ -0,6-0.5984881774657830,4531213562 Bacterial control measured at mid-exponential growth phase
Retrieved 1 of 1 entries in 0,8 ms (Link to these results)