Host taxon 9606
Protein NP_694542.1
follicular dendritic cell secreted peptide precursor
Homo sapiens
Gene FDCSP, UniProt Q8NFU4
>NP_694542.1|Haemophilus ducreyi 35000HP|follicular dendritic cell secreted peptide precursor
MKKVLLLITAILAVAVGFPVSQDQEREKRSISDSDELASGFFVFPYPYPFRPLPPIPFPRFPWFRRNFPIPIPESAPTTPLPSEK
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 8.44 | 8.44256325819928 | 6.4e-10 | 31213562 | |
Retrieved 1 of 1 entries in 3.6 ms
(Link to these results)