Host taxon 9606   Protein NP_694542.1

follicular dendritic cell secreted peptide precursor

Homo sapiens

Gene FDCSP, UniProt Q8NFU4

>NP_694542.1|Haemophilus ducreyi 35000HP|follicular dendritic cell secreted peptide precursor
MKKVLLLITAILAVAVGFPVSQDQEREKRSISDSDELASGFFVFPYPYPFRPLPPIPFPRFPWFRRNFPIPIPESAPTTPLPSEK

 

Show protein visualisation   Find similar proteins   Download Table  
Host  Pathogen  Organism  Tissue  Time Post-Infection  Log2 Fold Change  p-Value  Reference  Note 
Human (Homo sapiens)9606Haemophilus ducreyi 35000HP 233412infected hostSkin tissue6-8 days●●●●● 8,448.442563258199286,4e-1031213562
Retrieved 1 of 1 entries in 0,8 ms (Link to these results)