Host taxon 9606   Protein NP_001185683.1

guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2

Homo sapiens

Gene GNGT2, UniProt O14610

>NP_001185683.1|Haemophilus ducreyi 35000HP|guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2
MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS
Host  Pathogen  Organism  Tissue  Time Post-Infection  Log2 Fold Change  p-Value  Reference  Note 
Human (Homo sapiens)9606Haemophilus ducreyi 35000HP 233412infected hostSkin tissue6-8 days●●●●○ 3,113.107629565200414,1e-831213562
Retrieved 1 of 1 entries in 1 ms (Link to these results)