Bacterial taxon 233412   Protein WP_010944742.1

heme exporter protein CcmD

Haemophilus ducreyi 35000HP

Gene ccmD, UniProt Q7VN09

>WP_010944742.1|Haemophilus ducreyi 35000HP|heme exporter protein CcmD
MQFQFESIADFFAMGNYYFYVWLSYGLAFLAVGGLIWLSYREQKTVLRIVKKNLTTRNAIKAKIAIK
Host  Pathogen  Organism  Tissue  Time Post-Infection  Log2 Fold Change  p-Value  Reference  Note 
Human (Homo sapiens)9606Haemophilus ducreyi 35000HP 233412pathogenSkin tissue6-8 days●○○○○ -0.46-0.4619989690141980.5531213562 Bacterial control measured at mid-exponential growth phase
Retrieved 1 of 1 entries in 1 ms (Link to these results)