Bacterial taxon 233412   Protein WP_010944849.1

hypothetical protein

Haemophilus ducreyi 35000HP

Gene n/a, UniProt Q7VMQ7

>WP_010944849.1|Haemophilus ducreyi 35000HP|hypothetical protein
MPNWCENRLTVNCEPSRLNEIKSKLIRYNDESNPILDFNLLIPMPEELDIVSGGFGERTKIMLEMPQDLPLTEDFIARHIAAYDTNDMCYLHLSLLSQQEQWQVKDFVQWLDEHPDKQAKYQYDLPLGRQYLNNIAKYGASDWYHWCIKNWGTKWNAEMLDDSILEGQKHSLECFFNTAWCPPEEWFHSLCTAFKDCELKLYFYEPGMCFAGFFESHADNYISYYVQGQNKVDAFAQEYIYI

 

Show protein visualisation   Find similar proteins   Download Table  
Host  Pathogen  Organism  Tissue  Time Post-Infection  Log2 Fold Change  p-Value  Reference  Note 
Human (Homo sapiens)9606Haemophilus ducreyi 35000HP 233412pathogenSkin tissue6-8 days●○○○○ 0,160.1643410626194710,8731213562 Bacterial control measured at mid-exponential growth phase
Retrieved 1 of 1 entries in 0,7 ms (Link to these results)