Bacterial taxon 233412   Protein WP_010944131.1

succinate dehydrogenase assembly factor 2

Haemophilus ducreyi 35000HP

Gene sdhE, UniProt Q7VPK3

>WP_010944131.1|Haemophilus ducreyi 35000HP|succinate dehydrogenase assembly factor 2
MAELNRFKIEWQCRRGMRELDKMIMPFYQQYFEQLSEAEQRTFVTMLSYTDPELFRWVMHQSPAPTVAISALIERIRASIEA

 

Show protein visualisation   Find similar proteins   Download Table  
Host  Pathogen  Organism  Tissue  Time Post-Infection  Log2 Fold Change  p-Value  Reference  Note 
Human (Homo sapiens)9606Haemophilus ducreyi 35000HP 233412pathogenSkin tissue6-8 days●●○○○ 1,031.025936960363740,01831213562 Bacterial control measured at mid-exponential growth phase
Retrieved 1 of 1 entries in 1,4 ms (Link to these results)