Host taxon 10090   Protein NP_038680.1

C-C motif chemokine 4 precursor

Mus musculus

Gene Ccl4, UniProt P14097

>NP_038680.1|Pseudomona aeruginosa PA01|C-C motif chemokine 4 precursor
MKLCVSALSLLLLVAAFCAPGFSAPMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN

 

Show protein visualisation   Find similar proteins   Download Table  
Host  Pathogen  Organism  Tissue  Time Post-Infection  Log2 Fold Change  p-Value  Reference  Note 
Mouse (Mus musculus)10090Pseudomona aeruginosa PA01 208964infected hostLung tissue16 h●●●●● 7,197.191419005874196,6e-17232071273
Retrieved 1 of 2 entries in 1,3 ms (Link to these results)