Host taxon 10090
Protein NP_038680.1
C-C motif chemokine 4 precursor
Mus musculus
Gene Ccl4, UniProt P14097
>NP_038680.1|Pseudomona aeruginosa PA01|C-C motif chemokine 4 precursor
MKLCVSALSLLLLVAAFCAPGFSAPMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 7.19 | 7.19141900587419 | 6.6e-172 | 32071273 | |
Retrieved 1 of 2 entries in 5.6 ms
(Link to these results)