Bacterial taxon 208964   Protein WP_003083738.1

hypothetical protein

Pseudomona aeruginosa PA01

Gene n/a, UniProt Q9I721

>WP_003083738.1|Pseudomona aeruginosa PA01|hypothetical protein
MSLAIPMPERPRRARGRLQLLAIIGLVVGPMLLASAMYKWNFWVPQGRSYSGALIGNGQTPADLGVQGRSQGEQWQLLVTAPGTCGEDCQQLVYLARQINIALGREASRAGHALAASGELPADFANLVRQDYPRLQRYGLDPALYDKAGGGERPLLWVVDPHGNLVLRYDAKANGKKLLKDVQLLLKLSHIG

 

Show protein visualisation   Find similar proteins   Download Table  
Host  Pathogen  Organism  Tissue  Time Post-Infection  Log2 Fold Change  p-Value  Reference  Note 
Mouse (Mus musculus)10090Pseudomona aeruginosa PA01 208964pathogenLung tissue16 h●●●●● -4,69-4.689570733628468,5e-1232071273 Bacterial control measured at 37ºC
Retrieved 1 of 1 entries in 0,7 ms (Link to these results)