Host taxon 10090   Protein NP_780636.1

protein FAM163B

Mus musculus

Gene Fam163b, UniProt Q8BUM6

>NP_780636.1|Pseudomona aeruginosa PA01|protein FAM163B
MTAGTVVITGGILATVILLCIIAVLCYCRLQYYCCKKDESEEDEEEPDFAVHSHLPPLHSNRNLVLTNGPALYPAATTSFSQKSPQARALCRSCSHYEPPTFFLQEPEDEDFEGVRNGGGRVAYKSISQEDVELPSASFGGLQALNPNRLSAMREAFSRSRSVSTDV

 

Show protein visualisation   Find similar proteins   Download Table  
Host  Pathogen  Organism  Tissue  Time Post-Infection  Log2 Fold Change  p-Value  Reference  Note 
Mouse (Mus musculus)10090Pseudomona aeruginosa PA01 208964infected hostLung tissue16 h●●●●○ 3,593.594561131237262,2e-832071273
Retrieved 1 of 2 entries in 0,8 ms (Link to these results)