Bacterial taxon 216597   Protein WP_000178733.1

VirK family antimicrobial peptide resistance protein

Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344

Gene virK, UniProt A0A0H3NQL0

>WP_000178733.1|Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344|VirK family antimicrobial peptide resistance protein
MTMQQSDMERYNPLLMLKEVMAQTPYRHKRWGERKFRYKFLLRCLINPVTTIKYFNELCHLSQPRTLIIHRPLLPAKIQRPYLYTGLSIRCRAKAILEHYQFVQSFPESKIKKILLSEEQILLAHLEGKNGALVDIYCGPCGYDREGELTLTLCFNDTPLARLSFSFIRHEGKQIALVAGLQGPSKHIGPQVIRNATKDCYGLFPKRMLYEAFATLMQACNVDEIYAVSENNHVYRQLRYLFQKKKTFVASYSEFWESLNGVKKGALYHLPSQVMRKAPESIPSKKRAEYRKRYHILDTIIQEVNSLSR
Host  Pathogen  Organism  Tissue  Time Post-Infection  Log2 Fold Change  p-Value  Reference  Note 
Human (Homo sapiens)9606Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 216597pathogenEpithelial infected cells24 h●●●●● 7,417.409753105698673,5e-8232071273 Bacterial control measured at 37ºC
Human (Homo sapiens)9606Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 216597pathogenEndotelial infected cells24 h●●●●● 6,946.936195497651165,0e-7532071273 Bacterial control measured at 37ºC
Human (Homo sapiens)9606Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 216597pathogenNK infected cells24 h●●●●● 5,375.369039165838710,0332071273 Bacterial control measured at 37ºC
Human (Homo sapiens)9606Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 216597pathogenEpithelial bystander cells24 h●●●●● 4,484.484816780937474,8e-532071273 Bacterial control measured at 37ºC
Human (Homo sapiens)9606Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 216597pathogenHela-S3 cells4 h●●●●● 4,034.025200890603070,0005726789254 Bacterial control measured at 37ºC
Human (Homo sapiens)9606Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 216597pathogenMonocytic infected cells24 h●●●●○ 3,423.424012320394160,02232071273 Bacterial control measured at 37ºC
Human (Homo sapiens)9606Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 216597pathogenHela-S3 cells24 h●●●○○ 2,592.592033117391890,04226789254 Bacterial control measured at 37ºC
Retrieved 7 of 1 entries in 0,9 ms (Link to these results)