Host taxon 9606
Protein NP_001027903.1
2'-5'-oligoadenylate synthase 2 isoform 3
Homo sapiens
Gene OAS2, UniProt P29728
>NP_001027903.1|Haemophilus ducreyi 35000HP|2'-5'-oligoadenylate synthase 2 isoform 3
MGNGESQLSSVPAQKLGWFIQEYLKPYEECQTLIDEMVNTICDVLQEPEQFPLVQGVAIGGSYGRKTVLRGNSDGTLVLFFSDLKQFQDQKRSQRDILDKTGDKLKFCLFTKWLKNNFEIQKSLDGFTIQVFTKNQRISFEVLAAFNALSKHCWVSGEKSQRSGCQTALCNL
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.45 | 3.44980542580433 | 1.4e-10 | 31213562 | |
Retrieved 1 of 2 entries in 71.9 ms
(Link to these results)