Bacterial taxon 233412
Protein WP_005598105.1
30S ribosomal protein S18
Haemophilus ducreyi 35000HP
Gene rpsR, UniProt P66458
>WP_005598105.1|Haemophilus ducreyi 35000HP|30S ribosomal protein S18
MARYFRRRKFCRFTAENVVEIDYKDIATLKNYISESGKIVPSRITGTRAKYQRQLARAIKRARYLALLPYTDNHQ
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | pathogen | Skin tissue | 6-8 days | ●○○○○ 0.74 | 0.739414021022234 | 2.6e-5 | 31213562 | Bacterial control measured at mid-exponential growth phase |
Retrieved 1 of 1 entries in 27.7 ms
(Link to these results)