Bacterial taxon 233412
Protein WP_010945640.1
50S ribosomal protein L10
Haemophilus ducreyi 35000HP
Gene rplJ, UniProt Q7VKL4
>WP_010945640.1|Haemophilus ducreyi 35000HP|50S ribosomal protein L10
MALNLQDKQAIVAEVNEAAKGALSAVVADSRGVTVEKMTELRKSAREAGVTMRVVRNTLLRRAVEGTEFECLTDTFTGPTLIAFSNEHPGAAARLFTEFAKTNKEFELKGAAFEGKVQNVEFLATLPTYEEAIARLMGTMKEAAAGKLVRTFAALRDKLQEAA
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | pathogen | Skin tissue | 6-8 days | ●○○○○ 0.66 | 0.658709640891974 | 0.00091 | 31213562 | Bacterial control measured at mid-exponential growth phase |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)