Bacterial taxon 233412
Protein WP_010945567.1
8-oxo-dGTP diphosphatase MutT
Haemophilus ducreyi 35000HP
Gene mutT, UniProt Q7VKT4
>WP_010945567.1|Haemophilus ducreyi 35000HP|8-oxo-dGTP diphosphatase MutT
MTKPLIQVAAGIIRNEFGQIYVTQRLAGQDFAQALEFPGGKVALQETPEQALKRELEEEIGIHILGAFPYEHFCFEYPTKVIEFFFYLVEEWVGEPFGREGQAGFWITQMDLDEAEFPPANTQLIRRLKSEY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | pathogen | Skin tissue | 6-8 days | ●○○○○ -0.75 | -0.75204211560049 | 0.031 | 31213562 | Bacterial control measured at mid-exponential growth phase |
Retrieved 1 of 1 entries in 59 ms
(Link to these results)