Host taxon 9606
Protein NP_003055.1
antileukoproteinase precursor
Homo sapiens
Gene SLPI, UniProt P03973
>NP_003055.1|Haemophilus ducreyi 35000HP|antileukoproteinase precursor
MKSSGLFPFLVLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.07 | 3.07455633776118 | 1.4e-6 | 31213562 | |
Retrieved 1 of 1 entries in 63.8 ms
(Link to these results)