Host taxon 9606
Protein NP_001634.1
apolipoprotein A-II preproprotein
Homo sapiens
Gene APOA2, UniProt P02652
>NP_001634.1|Haemophilus ducreyi 35000HP|apolipoprotein A-II preproprotein
MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 4.82 | 4.81935889845373 | 1.6e-13 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)