Host taxon 9606
Protein NP_001191335.1
arachidonate 5-lipoxygenase-activating protein isoform 2
Homo sapiens
Gene ALOX5AP, UniProt P20292
>NP_001191335.1|Haemophilus ducreyi 35000HP|arachidonate 5-lipoxygenase-activating protein isoform 2
MLTFNHDAPWHTQKTLKTSEFGKSFGTLGHIGNISHQCWAGCAAGGRAVLSGEPEANMDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.63 | 3.6294819358451 | 2.6e-10 | 31213562 | |
Retrieved 1 of 2 entries in 23.8 ms
(Link to these results)