Host taxon 9606
Protein NP_001774.1
B-cell antigen receptor complex-associated protein alpha chain isoform 1 precursor
Homo sapiens
Gene CD79A, UniProt P11912
>NP_001774.1|Haemophilus ducreyi 35000HP|B-cell antigen receptor complex-associated protein alpha chain isoform 1 precursor
MPGGPGVLQALPATIFLLFLLSAVYLGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEKP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 4.16 | 4.15649874401199 | 1.0e-15 | 31213562 | |
Retrieved 1 of 1 entries in 37.1 ms
(Link to these results)