Host taxon 9606
Protein NP_006390.1
basic leucine zipper transcriptional factor ATF-like
Homo sapiens
Gene BATF, UniProt Q16520
>NP_006390.1|Haemophilus ducreyi 35000HP|basic leucine zipper transcriptional factor ATF-like
MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 4.33 | 4.33450366411559 | 3.2e-12 | 31213562 | |
Retrieved 1 of 1 entries in 43.5 ms
(Link to these results)