Host taxon 9606
Protein NP_061134.1
basic leucine zipper transcriptional factor ATF-like 3
Homo sapiens
Gene BATF3, UniProt Q9NR55
>NP_061134.1|Haemophilus ducreyi 35000HP|basic leucine zipper transcriptional factor ATF-like 3
MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESLEQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDPVAGCLPR
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 4.02 | 4.01983122847475 | 3.1e-10 | 31213562 | |
Retrieved 1 of 1 entries in 26.2 ms
(Link to these results)