Host taxon 9606
Protein NP_004039.1
beta-2-microglobulin precursor
Homo sapiens
Gene B2M, UniProt P61769
>NP_004039.1|Haemophilus ducreyi 35000HP|beta-2-microglobulin precursor
MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.83 | 2.82586014899118 | 4.2e-10 | 31213562 | |
Retrieved 1 of 1 entries in 42.2 ms
(Link to these results)