Host taxon 9606
Protein NP_001192195.1
beta-defensin 4B precursor
Homo sapiens
Gene n/a, UniProt O15263
>NP_001192195.1|Haemophilus ducreyi 35000HP|beta-defensin 4B precursor
MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 9.69 | 9.68703892642654 | 0.00014 | 31213562 | |
Retrieved 1 of 1 entries in 2.9 ms
(Link to these results)