Host taxon 9606
Protein NP_006265.1
C-C motif chemokine 19 precursor
Homo sapiens
Gene CCL19, UniProt Q99731
>NP_006265.1|Haemophilus ducreyi 35000HP|C-C motif chemokine 19 precursor
MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.01 | 3.01340733327769 | 5.5e-7 | 31213562 | |
Retrieved 1 of 2 entries in 201.7 ms
(Link to these results)