Host taxon 9606
Protein NP_001001437.2
C-C motif chemokine 3-like 1 precursor
Homo sapiens
Gene n/a, UniProt P16619
>NP_001001437.2|Haemophilus ducreyi 35000HP|C-C motif chemokine 3-like 1 precursor
MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 8.28 | 8.27980768511962 | 2.6e-12 | 31213562 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)