Host taxon 9606
Protein NP_001278397.1
C-C motif chemokine 4-like isoform 1 precursor
Homo sapiens
Gene n/a, UniProt Q8NHW4
>NP_001278397.1|Haemophilus ducreyi 35000HP|C-C motif chemokine 4-like isoform 1 precursor
MKLCVTVLSLLVLVAAFCSLALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVGKQVCADPSESWVQEYVYDLELN
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 6.55 | 6.55212320868438 | 0.0018 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)