Host taxon 9606
Protein NP_001007034.1
C-type lectin domain family 6 member A isoform 1
Homo sapiens
Gene CLEC6A, UniProt Q6EIG7
>NP_001007034.1|Haemophilus ducreyi 35000HP|C-type lectin domain family 6 member A isoform 1
MMQEQQPQSTEKRGWLSLRLWSVAGISIALLSACFIVSCVVTYHFTYGETGKRLSELHSYHSSLTCFSEGTKVPAWGCCPASWKSFGSSCYFISSEEKVWSKSEQNCVEMGAHLVVFNTEAEQNFIVQQLNESFSYFLGLSDPQGNNNWQWIDKTPYEKNVRFWHLGEPNHSAEQCASIVFWKPTGWGWNDVICETRRNSICEMNKIYL
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 8.21 | 8.21223428659956 | 7.5e-18 | 31213562 | |
Retrieved 1 of 1 entries in 28.8 ms
(Link to these results)