Host taxon 9606
Protein NP_072092.2
C-type lectin domain family 7 member A isoform b
Homo sapiens
Gene CLEC7A, UniProt Q9BXN2
>NP_072092.2|Haemophilus ducreyi 35000HP|C-type lectin domain family 7 member A isoform b
MEYHPDLENLDEDGYTQLHFDSQSNTRIAVVSEKGSCAASPPWRLIAVILGILCLVILVIAVVLGTMGVLSSPCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFSM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.39 | 3.38658583237526 | 6.6e-12 | 31213562 | |
Retrieved 1 of 4 entries in 7.1 ms
(Link to these results)