Host taxon 9606
Protein NP_001289052.1
C-X-C motif chemokine 11 isoform 2 precursor
Homo sapiens
Gene CXCL11, UniProt O14625
>NP_001289052.1|Haemophilus ducreyi 35000HP|C-X-C motif chemokine 11 isoform 2 precursor
MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKLKERIFKNIKTYEVLEKSI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 7.8 | 7.80170748444552 | 2.5e-11 | 31213562 | |
Retrieved 1 of 1 entries in 3 ms
(Link to these results)