Host taxon 9606
Protein NP_002985.1
C-X-C motif chemokine 5 precursor
Homo sapiens
Gene CXCL5, UniProt P42830
>NP_002985.1|Haemophilus ducreyi 35000HP|C-X-C motif chemokine 5 precursor
MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 8.27 | 8.27421924088278 | 4.1e-8 | 31213562 | |
Retrieved 1 of 2 entries in 1.3 ms
(Link to these results)