Host taxon 9606
Protein NP_001808.2
carcinoembryonic antigen-related cell adhesion molecule 4 isoform 1 precursor
Homo sapiens
Gene CEACAM4, UniProt O75871
>NP_001808.2|Haemophilus ducreyi 35000HP|carcinoembryonic antigen-related cell adhesion molecule 4 isoform 1 precursor
MGPPSAAPRGGHRPWQGLLITASLLTFWHPPTTVQFTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAGIVTGVLVGVALVAALVCFLLLSRTGRASIQRDLREQPPPASTPGHGPSHRSTFSAPLPSPRTATPIYEELLYSDANIYCQIDHKADVVS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 5.35 | 5.35084535256945 | 0.00018 | 31213562 | |
Retrieved 1 of 3 entries in 0.7 ms
(Link to these results)