Host taxon 9606
Protein NP_001017534.1
caspase recruitment domain-containing protein 16 isoform 1
Homo sapiens
Gene CARD16, UniProt Q5EG05
>NP_001017534.1|Haemophilus ducreyi 35000HP|caspase recruitment domain-containing protein 16 isoform 1
MADKVLKEKRKLFIHSMGEGTINGLLDELLQTRVLNQEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAETLGLSAALQAVQDNPAMPTCSSPEGRIKLCFLEDAQRIWKQKLQRCHVQNTIIKWSERYTSGSFEMQWLFLRTNFIERFWRNILLLPLHKGSLYPRIPGLGKELQTGTHKLS
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.62 | 3.61904231051952 | 5.8e-18 | 31213562 | |
Retrieved 1 of 1 entries in 21.8 ms
(Link to these results)