Host taxon 9606
Protein NP_001035370.1
CD83 antigen isoform b precursor
Homo sapiens
Gene CD83, UniProt Q01151
>NP_001035370.1|Haemophilus ducreyi 35000HP|CD83 antigen isoform b precursor
MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 4.06 | 4.05732938589767 | 3.2e-12 | 31213562 | |
Retrieved 1 of 2 entries in 21.3 ms
(Link to these results)