Host taxon 9606
Protein NP_659494.2
cdc42 effector protein 5
Homo sapiens
Gene CDC42EP5, UniProt Q6NZY7
>NP_659494.2|Haemophilus ducreyi 35000HP|cdc42 effector protein 5
MPVLKQLGPAQPKKRPDRGALSISAPLGDFRHTLHVGRGGDAFGDTSFLSRHGGGPPPEPRAPPAGAPRSPPPPAVPQSAAPSPADPLLSFHLDLGPSMLDAVLGVMDAARPEAAAAKPDAEPRPGTQPPQARCRPNADLELNDVIGL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● -6.65 | -6.65091759657921 | 0.03 | 31213562 | |
Retrieved 1 of 1 entries in 37.6 ms
(Link to these results)