Host taxon 9606
Protein NP_000720.1
cholecystokinin preproprotein
Homo sapiens
Gene CCK, UniProt P06307
>NP_000720.1|Haemophilus ducreyi 35000HP|cholecystokinin preproprotein
MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.44 | 3.43860086974758 | 0.046 | 31213562 | |
Retrieved 1 of 2 entries in 45.9 ms
(Link to these results)