Host taxon 9606
Protein NP_001276011.1
CMRF35-like molecule 1 isoform 2
Homo sapiens
Gene CD300LF, UniProt Q8TDQ1
>NP_001276011.1|Haemophilus ducreyi 35000HP|CMRF35-like molecule 1 isoform 2
MWLPQLDLMRVISAKSQGYSIVTQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNSSRDVPRAGTAAPGGRPLLCRPDPAAGRNLPAKGYHEAFLCPG
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 4.6 | 4.60079338594638 | 5.9e-12 | 31213562 | |
Retrieved 1 of 2 entries in 2.1 ms
(Link to these results)