Host taxon 9606
Protein NP_066972.1
coactosin-like protein
Homo sapiens
Gene COTL1, UniProt Q14019
>NP_066972.1|Haemophilus ducreyi 35000HP|coactosin-like protein
MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQTE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.12 | 3.12142850399586 | 5.1e-12 | 31213562 | |
Retrieved 1 of 1 entries in 32.2 ms
(Link to these results)