Host taxon 9606
Protein NP_000482.3
complement C1q subcomponent subunit B isoform 1 precursor
Homo sapiens
Gene C1QB, UniProt P02746
>NP_000482.3|Haemophilus ducreyi 35000HP|complement C1q subcomponent subunit B isoform 1 precursor
MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.88 | 3.87701626737091 | 1.7e-19 | 31213562 | |
Retrieved 1 of 1 entries in 3.1 ms
(Link to these results)