Host taxon 9606
Protein NP_115877.2
cornifelin
Homo sapiens
Gene CNFN, UniProt Q9BYD5
>NP_115877.2|Haemophilus ducreyi 35000HP|cornifelin
MSYPVTSQPQCATTSCYQTQLSDWHTGLTDCCNDMPVCLCGTFAPLCLACRISDDFGECCCAPYLPGGLHSIRTGMRERYHIQGSVGHDWAALTFCLPCALCQMARELKIRE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.15 | 3.15332693828481 | 5.7e-9 | 31213562 | |
Retrieved 1 of 1 entries in 26.7 ms
(Link to these results)