Host taxon 9606
Protein NP_003116.2
cornifin-B
Homo sapiens
Gene SPRR1B, UniProt P22528
>NP_003116.2|Haemophilus ducreyi 35000HP|cornifin-B
MSSQQQKQPCTPPPQLQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPEPCHPKVPEPCPSIVTPAPAQQKTKQK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.37 | 3.3728418571716 | 1.1e-9 | 31213562 | |
Retrieved 1 of 1 entries in 2.8 ms
(Link to these results)