Host taxon 9606
Protein NP_003641.3
cystatin-F precursor
Homo sapiens
Gene CST7, UniProt O76096
>NP_003641.3|Haemophilus ducreyi 35000HP|cystatin-F precursor
MRAAGTLLAFCCLVLSTTGGPSPDTCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKFNNCTNDMFLFKESRITRALVQIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.46 | 3.45885892119967 | 2.7e-8 | 31213562 | |
Retrieved 1 of 1 entries in 97.9 ms
(Link to these results)