Host taxon 9606
Protein NP_001032720.1
cytotoxic T-lymphocyte protein 4 isoform CTLA-4delTM
Homo sapiens
Gene CTLA4, UniProt P16410
>NP_001032720.1|Haemophilus ducreyi 35000HP|cytotoxic T-lymphocyte protein 4 isoform CTLA-4delTM
MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIAKEKKPSYNRGLCENAPNRARM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 4.46 | 4.4645154396033 | 1.9e-12 | 31213562 | |
Retrieved 1 of 1 entries in 30 ms
(Link to these results)