Bacterial taxon 233412
Protein WP_010945454.1
DeoR/GlpR family transcriptional regulator
Haemophilus ducreyi 35000HP
Gene glpR, UniProt Q7VL37
>WP_010945454.1|Haemophilus ducreyi 35000HP|DeoR/GlpR family transcriptional regulator
MKQSIRHNKIIELVNQLGYVSTEELVAQLAVSSQTIRRDLNELAEKNLLRRHHGGAGMPSNNENSDYSERKKFFSAQKNIIAQQVAEMIPNGSSLFLDIGTTSEAVAYALLSHQHLRIVTNNLNAAHILMQKDDFQITIAGGDLRADGGIIGEATVNFISEFRLDFGILGISAIDQDGSMLDYDYHEVQVKRALMQSSRQVILVTDHSKFNRRAIVRLGNISEVNYLFTDLPLPLELQQYLAPTNVTVYICNN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | pathogen | Skin tissue | 6-8 days | ●○○○○ -0.85 | -0.846881716160193 | 0.029 | 31213562 | Bacterial control measured at mid-exponential growth phase |
Retrieved 1 of 1 entries in 11.8 ms
(Link to these results)